PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.8689s0019.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 397aa    MW: 44554.7 Da    PI: 6.4563
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.8689s0019.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.3e-344599155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprl+Wtp+LHerFveav+qLGG +kAtPkti+++m+++gLtl+h+kSHLQkYRl
  Araha.8689s0019.4.p 45 KPRLKWTPDLHERFVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 99
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.15542102IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-3243100IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-2445100IPR006447Myb domain, plants
PfamPF002491.0E-104798IPR001005SANT/Myb domain
PfamPF143791.0E-15146186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MYYQNQHQGK SILSSSRMPI HSERNPFLRG NGTGDSGLIL STDAKPRLKW TPDLHERFVE  60
AVNQLGGGDK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANSS LNKTSVMTMV  120
EENPPEVDES HSESLSIGPQ PTMNLPISDA LQMQIEVQRR LHEQLELRIE AQGKYLQSIL  180
EKAQETLGRQ NLGAAGIEAT KAQLSELVSK VSAEYPDSSF LEPKELQNLR HQQMQTAYPP  240
NSSLDSCLTS SEGNQKAPKM LDNRLGLRTY IGDSTSEQKE IMEEPFFHRM ELTWAEEVSL  300
RESNNRPYLS TMANNAEPRI SSSRRSPGRL SIGVGVHEHR GGSSNNSEYT EERFNENGED  360
CKLETHTRTA LDLNTHDENY GTTRPKQFDL NGFSWN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2918170.0AF291817.1 Arabidopsis thaliana MYR1 (MYR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850842.10.0myb-related protein 1
RefseqNP_974797.10.0myb-related protein 1
TrEMBLQ9C5Y60.0Q9C5Y6_ARATH; MYR1
STRINGAT5G18240.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.30.0myb-related protein 1